(£) GBP (Default)
  • ($) USD
  • (€) EUR
  • ($) AUD
  • ($) CAD
  • ($) NZD

LL-37 Thymosin Alpha-1 Peptide Stack

The combination of LL-37 (CAP 18) and Thymosin Alpha-1 peptides presents a promising approach in biomedical applications, particularly due to their immunomodulatory properties. LL-37, an antimicrobial peptide, is known for its ability to stimulate host defence against microbes and reduce pro-inflammatory cytokine responses. Meanwhile, Thymosin Alpha-1 can prime dendritic cells and enhance Th1 and Treg cells, helping to balance inflammation, making it a commonly used immune enhancer in viral infectious diseases.

This LL-37 Thymosin Alpha-1 peptide stack contains:

LL-37 (Cap-18) 5mg peptide vial

Thymosin Alpha-1 10mg peptide vial

Save 10% based on buying vials individually.

 

Original price was: £95.00.Current price is: £85.50.

SKU PG-LL-37-5mg-Thymosin-Alpha-1-10mg-Vial-Stack Categories , , ,

485 in stock

LL-37 Thymosin Alpha-1 Peptide Stack

The combination of LL-37 Thymosin Alpha-1 peptides is a promising approach in the biomedical field due to their immunomodulatory properties. Both these peptides have been extensively studied for their potential therapeutic applications, and their combined use has opened new avenues of research. In particular, the combination of LL-37’s ability to control inflammation and Thymosin Alpha-1’s capacity to boost immune function can be incredibly beneficial in treating conditions that involve an overactive immune response or require a boosted immune reaction.

Recent studies have focused on the development of a hybrid peptide LL-37Tα1, which combines the properties of both LL-37 and Thymosin Alpha-1. This hybrid peptide is being explored for its potential biomedical applications. The fusion of these two peptides aims to leverage their combined benefits, potentially offering enhanced therapeutic effects compared to their individual use. As such, this hybrid peptide could potentially be employed in the treatment of autoimmune diseases, viral infections, cancers, and other conditions that necessitate immune modulation. Whilst the blended peptide is still under investigation, Pharma Grade Store offers this LL-37 Thymosin Alpha-1 peptide stack for research purposes.

 

LL-37 (CAP-18)

LL-37, also known as CAP-18, is an antimicrobial peptide that has been shown to stimulate host defenses against various microbes. It reduces pro-inflammatory cytokine responses, making it an effective tool in controlling inflammation. This peptide is known for its antimicrobial, antiviral, and antifungal properties, making it a versatile weapon in the human body’s arsenal against pathogens. Research has demonstrated LL-37’s ability to affect both planktonic bacteria and those residing in biofilms, as well as viruses such as HIV and various fungi. Furthermore, LL-37 suppresses the production of pro-inflammatory cytokines, such as TNF-α and IL-6, in infected monocytes. The peptide is also known to increase cytokine and chemokine liberation.

Amino Acid Sequence: [LL-37, 37 aa]

Molecular Formula: C205H340N60O53

 

Thymosin Alpha-1

Thymosin Alpha-1, on the other hand, is a synthetic version of a naturally occurring peptide found in the thymus gland. It modulates host immune responses and has been used as an immune enhancer in various viral infectious diseases. Thymosin Alpha-1 can prime dendritic cells, enhance Th1 and Treg cells, and help balance inflammation. It has been shown to be beneficial in boosting immune function and fighting inflammation.

Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH

Molecular Formula: C129H215N33O55

References:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6587124/

https://www.mdpi.com/2309-608X/6/4/241

https://www.researchgate.net/publication/7066014

 

Buy LL-37 Thymosin Alpha-1 Peptide Stack Online From Pharmagrade Store Today!

 

ALL PRODUCT INFORMATION AND ARTICLES ON THIS SITE ARE FOR EDUCATIONAL PURPOSES ONLY

DISCLAIMER: All products sold by PharmaGrade.Store are for research and laboratory use only. These products are not designed for use or consumption by humans or animals. They are not to be classified as a drug, food, cosmetic, or medicinal product and must not be mislabelled or used as such. By purchasing from our Website the buyer accepts and acknowledges the risks involved with handling of these products. All articles and product information provided on this Website are for informational and educational purposes only. Handling and use of these products should be restricted to suitably qualified professionals.